SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ffxd_ (5ffx D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (65 species)
    not a true protein
  7. 1983986Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 2284019Domain d5ffxd_: 5ffx D: [327320]
    automated match to d4llla_
    complexed with gol, so4; mutant

Details for d5ffxd_

PDB Entry: 5ffx (more details), 1.47 Å

PDB Description: s. aureus mepr g34k mutant
PDB Compounds: (D:) MarR family regulatory protein

SCOPe Domain Sequences for d5ffxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ffxd_ a.4.5.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ftysylfrmishemkqkadqkleqfditneqkhtlgylyahqqdgltqndiakalqrtgp
tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

SCOPe Domain Coordinates for d5ffxd_:

Click to download the PDB-style file with coordinates for d5ffxd_.
(The format of our PDB-style files is described here.)

Timeline for d5ffxd_:

  • d5ffxd_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22