SCOPe 2.06: Domain d1thxa_: 1thx A:

Lineage for d1thxa_ (1thx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [52837] (1 PDB entry)
   thioredoxin H

8. Domain d1thxa_: 1thx A: [32732]

Details for d1thxa_

PDB Entry: 1thx, 1.6 Å

PDB Description: thioredoxin-2

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1thxa_:

Sequence; same for both SEQRES and ATOM records:

>d1thxa_ c.47.1.1 (A:) Thioredoxin {Nostoc sp. PCC 7120 [TaxId: 103690]}
skgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvklei
dpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthln

Timeline for d1thxa_:

• d1thxa_ first appeared (with stable ids) in SCOP 1.55, called d1thx__
  
• d1thxa_ appears in SCOPe 2.05
  
• d1thxa_ appears in SCOPe 2.07
  
• d1thxa_ appears in the current release, SCOPe 2.08