Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (16 species) |
Species Nostoc sp. PCC 7120 [TaxId:103690] [52837] (1 PDB entry) thioredoxin H |
Domain d1thxa_: 1thx A: [32732] |
PDB Entry: 1thx (more details), 1.6 Å
SCOPe Domain Sequences for d1thxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Nostoc sp. PCC 7120 [TaxId: 103690]} skgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvklei dpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthln
Timeline for d1thxa_: