Lineage for d5ffha_ (5ffh A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)
  8. 2284014Domain d5ffha_: 5ffh A: [327315]
    automated match to d4efga_
    complexed with act, ret; mutant

Details for d5ffha_

PDB Entry: 5ffh (more details), 1.68 Å

PDB Description: crystal structure of the q108k:k40l:t51v:r58w:y19w mutant of human cellular retinol binding protein ii in complex with all-trans-retinal at 1.68 angstrom resolution
PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d5ffha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ffha_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegwmkaldidfatrkiavrltqtlvidqdgdnfkvkttstfwny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d5ffha_:

Click to download the PDB-style file with coordinates for d5ffha_.
(The format of our PDB-style files is described here.)

Timeline for d5ffha_:

  • d5ffha_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22