Lineage for d5fenb_ (5fen B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396280Protein automated matches [190295] (6 species)
    not a true protein
  7. 2396296Species Human (Homo sapiens) [TaxId:9606] [187133] (49 PDB entries)
  8. 2396359Domain d5fenb_: 5fen B: [327311]
    automated match to d4ruua_
    complexed with act, ret; mutant

Details for d5fenb_

PDB Entry: 5fen (more details), 1.55 Å

PDB Description: crystal structure of the q108k:k40l:t53c mutant of human cellular retinol binding protein ii in complex with all-trans-retinal after 24 hours of incubation at 1.55 angstrom resolution
PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d5fenb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fenb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkctstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d5fenb_:

Click to download the PDB-style file with coordinates for d5fenb_.
(The format of our PDB-style files is described here.)

Timeline for d5fenb_: