Lineage for d1xoa__ (1xoa -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395895Species Escherichia coli [TaxId:562] [52836] (11 PDB entries)
  8. 395909Domain d1xoa__: 1xoa - [32731]

Details for d1xoa__

PDB Entry: 1xoa (more details)

PDB Description: thioredoxin (oxidized disulfide form), nmr, 20 structures

SCOP Domain Sequences for d1xoa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoa__ c.47.1.1 (-) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d1xoa__:

Click to download the PDB-style file with coordinates for d1xoa__.
(The format of our PDB-style files is described here.)

Timeline for d1xoa__: