Lineage for d5euba_ (5eub A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2464581Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2464582Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2464583Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2464584Species Human (Homo sapiens) [TaxId:9606] [53175] (13 PDB entries)
    Uniprot Q13126
  8. 2464591Domain d5euba_: 5eub A: [327308]
    automated match to d1cb0a_
    complexed with 5s7, cl, gol, so4

Details for d5euba_

PDB Entry: 5eub (more details), 1.81 Å

PDB Description: crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
PDB Compounds: (A:) S-methyl-5'-thioadenosine phosphorylase

SCOPe Domain Sequences for d5euba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euba_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
vkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtimp
skvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgsh
scargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrtw
gadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankaks
lllttipqigstewsetlhnlknmaqfsvllp

SCOPe Domain Coordinates for d5euba_:

Click to download the PDB-style file with coordinates for d5euba_.
(The format of our PDB-style files is described here.)

Timeline for d5euba_: