SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5euba_ (5eub A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125405Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2125406Species Human (Homo sapiens) [TaxId:9606] [53175] (9 PDB entries)
    Uniprot Q13126
  8. 2284007Domain d5euba_: 5eub A: [327308]
    automated match to d1cb0a_
    complexed with 5s7, cl, gol, so4

Details for d5euba_

PDB Entry: 5eub (more details), 1.81 Å

PDB Description: crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
PDB Compounds: (A:) S-methyl-5'-thioadenosine phosphorylase

SCOPe Domain Sequences for d5euba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euba_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
vkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtimp
skvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgsh
scargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrtw
gadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankaks
lllttipqigstewsetlhnlknmaqfsvllp

SCOPe Domain Coordinates for d5euba_:

Click to download the PDB-style file with coordinates for d5euba_.
(The format of our PDB-style files is described here.)

Timeline for d5euba_:

  • d5euba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22