Lineage for d5b6wa_ (5b6w A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225116Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 protein domains)
  6. 2225121Protein Bacteriorhodopsin [56871] (2 species)
    a light-driven proton pump
  7. 2225126Species Halobacterium salinarum [TaxId:2242] [56873] (85 PDB entries)
    Uniprot P02945 17-245
  8. 2284005Domain d5b6wa_: 5b6w A: [327306]
    automated match to d1qhja_
    complexed with c14, d10, dd9, hp6, l2p, mys, oct, ret, trd, und

Details for d5b6wa_

PDB Entry: 5b6w (more details), 2.1 Å

PDB Description: a three dimensional movie of structural changes in bacteriorhodopsin: structure obtained 16 ns after photoexcitation
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d5b6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6wa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
ygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtgl
vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlws
aypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeae

SCOPe Domain Coordinates for d5b6wa_:

Click to download the PDB-style file with coordinates for d5b6wa_.
(The format of our PDB-style files is described here.)

Timeline for d5b6wa_:

  • d5b6wa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22