SCOPe 2.06: Domain d5c32d_: 5c32 D:

Lineage for d5c32d_ (5c32 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)
   automatically mapped to Pfam PF00239

5. Family c.53.1.0: automated matches [227230] (1 protein)
   not a true family

6. Protein automated matches [226976] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)

8. Domain d5c32d_: 5c32 D: [327303]
   automated match to d2rsla_
   complexed with so4

Details for d5c32d_

PDB Entry: 5c32, 3.05 Å

PDB Description: constitutively active sin recombinase cataltyic domain - i100t

PDB Compounds: (D:) Putative transposon Tn552 DNA-invertase bin3

SCOPe Domain Sequences for d5c32d_:

Sequence, based on SEQRES records:

>d5c32d_ c.53.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevtgnplldkfmkdliiqilamv
seqerne

Sequence, based on observed residues (ATOM records):

>d5c32d_ c.53.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnplldkfmkdliiqilamvseqer
ne

Timeline for d5c32d_:

• d5c32d_ is new in SCOPe 2.06-stable
  
• d5c32d_ appears in SCOPe 2.07
  
• d5c32d_ appears in the current release, SCOPe 2.08