Lineage for d5c35a_ (5c35 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121765Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2121766Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2121790Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 2121791Protein automated matches [226976] (3 species)
    not a true protein
  7. 2121795Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)
  8. 2283996Domain d5c35a_: 5c35 A: [327297]
    automated match to d2rslb_
    complexed with so4

Details for d5c35a_

PDB Entry: 5c35 (more details), 2.4 Å

PDB Description: constitutively active sin recombinase cataltyic domain - t77ii100t/q115r
PDB Compounds: (A:) Recombinase Sin

SCOPe Domain Sequences for d5c35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c35a_ c.53.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihivnylkdkevqlmitslpmmnevtgnplldkfmkdliirilamv
seqe

SCOPe Domain Coordinates for d5c35a_:

Click to download the PDB-style file with coordinates for d5c35a_.
(The format of our PDB-style files is described here.)

Timeline for d5c35a_:

  • d5c35a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22