SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5c3va_ (5c3v A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195459Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2195460Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2195517Family d.143.1.0: automated matches [191445] (1 protein)
    not a true family
  6. 2195518Protein automated matches [190664] (8 species)
    not a true protein
  7. 2276410Species Danio rerio [TaxId:7955] [319711] (2 PDB entries)
  8. 2283995Domain d5c3va_: 5c3v A: [327296]
    automated match to d3x05a_
    complexed with atp, ca

Details for d5c3va_

PDB Entry: 5c3v (more details), 3.15 Å

PDB Description: an enzyme with bound ligand and metal
PDB Compounds: (A:) Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha

SCOPe Domain Sequences for d5c3va_:

Sequence, based on SEQRES records: (download)

>d5c3va_ d.143.1.0 (A:) automated matches {Danio rerio [TaxId: 7955]}
ttssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkf
ktyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssddefiiktvqhk
eaeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfd
lkgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfk
imdysllvgihilhrageeastavpdtqkkgqgqkplyctaiesiqgesksktspqpyes
mggipafnskgerllvfigiidilqsyrlvkklehswkallhdgdtvsvhrpsfyadrfq
kfmcstvfrk

Sequence, based on observed residues (ATOM records): (download)

>d5c3va_ d.143.1.0 (A:) automated matches {Danio rerio [TaxId: 7955]}
ttssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkf
ktyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssddefiiktvqhk
eaeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfd
lkgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfk
imdysllvgihilhmggipafnskgerllvfigiidilqsyrtvsvhrpsfyadrfqkfm
cstvfrk

SCOPe Domain Coordinates for d5c3va_:

Click to download the PDB-style file with coordinates for d5c3va_.
(The format of our PDB-style files is described here.)

Timeline for d5c3va_:

  • d5c3va_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22