![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 protein domains) |
![]() | Protein automated matches [190696] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188122] (15 PDB entries) |
![]() | Domain d5bx1a_: 5bx1 A: [327295] automated match to d2mbca_ complexed with 4xa, so4 |
PDB Entry: 5bx1 (more details), 1.9 Å
SCOPe Domain Sequences for d5bx1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bx1a_ c.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld wpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkye davqfirqkrrgafnskqllylekyrpkmrlrf
Timeline for d5bx1a_: