| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
| Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
| Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries) Uniprot Q8DIN8 1-37 |
| Domain d5tisl_: 5tis l: [327294] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d2axtl1 complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tisl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tisl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d5tisl_: