Lineage for d5tisc_ (5tis C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634071Protein automated matches [191285] (5 species)
    not a true protein
  7. 2634081Species Thermosynechococcus elongatus [TaxId:197221] [260540] (5 PDB entries)
  8. 2634083Domain d5tisc_: 5tis C: [327293]
    Other proteins in same PDB: d5tisa_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d4pj0c_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisc_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d5tisc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisc_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d5tisc_:

Click to download the PDB-style file with coordinates for d5tisc_.
(The format of our PDB-style files is described here.)

Timeline for d5tisc_: