SCOPe 2.06: Domain d5tisc_: 5tis C:

Lineage for d5tisc_ (5tis C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260540] (4 PDB entries)

8. Domain d5tisc_: 5tis C: [327293]
   Other proteins in same PDB: d5tisj_, d5tisk_, d5tisl_, d5tism_
   automated match to d4pj0c_
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisc_

PDB Entry: 5tis, 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex

PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d5tisc_:

Sequence; same for both SEQRES and ATOM records:

>d5tisc_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

Timeline for d5tisc_:

• d5tisc_ is new in SCOPe 2.06-stable
  
• d5tisc_ appears in SCOPe 2.07
  
• d5tisc_ appears in the current release, SCOPe 2.08