Lineage for d1srx__ (1srx -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24138Protein Thioredoxin [52835] (7 species)
  7. 24146Species Escherichia coli [TaxId:562] [52836] (9 PDB entries)
  8. 24157Domain d1srx__: 1srx - [32729]

Details for d1srx__

PDB Entry: 1srx (more details), 2.8 Å

PDB Description: three-dimensional structure of escherichia coli thioredoxin-s2 to 2.8 angstroms resolution

SCOP Domain Sequences for d1srx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srx__ c.47.1.1 (-) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdlvkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkyiergiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d1srx__:

Click to download the PDB-style file with coordinates for d1srx__.
(The format of our PDB-style files is described here.)

Timeline for d1srx__: