Lineage for d5m93c1 (5m93 C:0-74)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (22 species)
    not a true protein
  7. 2159501Species Human (Homo sapiens) [TaxId:9606] [187090] (75 PDB entries)
  8. 2283983Domain d5m93c1: 5m93 C:0-74 [327284]
    Other proteins in same PDB: d5m93b2, d5m93c2
    automated match to d1mg8a_
    complexed with rib, so4

Details for d5m93c1

PDB Entry: 5m93 (more details), 1.79 Å

PDB Description: crystal structure of sdea-modified ubiquitin.
PDB Compounds: (C:) Polyubiquitin-B

SCOPe Domain Sequences for d5m93c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m93c1 d.15.1.0 (C:0-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
niqkestlhlvlrlr

SCOPe Domain Coordinates for d5m93c1:

Click to download the PDB-style file with coordinates for d5m93c1.
(The format of our PDB-style files is described here.)

Timeline for d5m93c1:

  • d5m93c1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-16