SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u2ka_ (5u2k A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (29 species)
    not a true protein
  7. 2069951Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries)
  8. 2283981Domain d5u2ka_: 5u2k A: [327282]
    automated match to d3ftta_
    complexed with cl, coa, edo, po4

Details for d5u2ka_

PDB Entry: 5u2k (more details), 1.38 Å

PDB Description: crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
PDB Compounds: (A:) galactoside o-acetyltransferase

SCOPe Domain Sequences for d5u2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2ka_ b.81.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
vrkidndlps

SCOPe Domain Coordinates for d5u2ka_:

Click to download the PDB-style file with coordinates for d5u2ka_.
(The format of our PDB-style files is described here.)

Timeline for d5u2ka_:

  • d5u2ka_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15