Lineage for d5u2ka_ (5u2k A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (30 species)
    not a true protein
  7. 2069951Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries)
  8. 2283981Domain d5u2ka_: 5u2k A: [327282]
    automated match to d3ftta_
    complexed with cl, coa, edo, po4

Details for d5u2ka_

PDB Entry: 5u2k (more details), 1.38 Å

PDB Description: crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
PDB Compounds: (A:) galactoside o-acetyltransferase

SCOPe Domain Sequences for d5u2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2ka_ b.81.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
vrkidndlps

SCOPe Domain Coordinates for d5u2ka_:

Click to download the PDB-style file with coordinates for d5u2ka_.
(The format of our PDB-style files is described here.)

Timeline for d5u2ka_:

  • d5u2ka_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15