SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u4qa1 (5u4q A:1-334)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2095243Species Klebsiella pneumoniae [TaxId:573] [225753] (3 PDB entries)
  8. 2283979Domain d5u4qa1: 5u4q A:1-334 [327280]
    Other proteins in same PDB: d5u4qa2, d5u4qb2
    automated match to d4lisa_
    complexed with cl, nad

Details for d5u4qa1

PDB Entry: 5u4q (more details), 1.5 Å

PDB Description: 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad.
PDB Compounds: (A:) dtdp-glucose 4,6-dehydratase

SCOPe Domain Sequences for d5u4qa1:

Sequence, based on SEQRES records: (download)

>d5u4qa1 c.2.1.0 (A:1-334) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkflvtgaagfigfhiaqrllneghnvvgidnmndyydvslkqarldrlaypafhfqqld
ladregmaklfateqfdrvihlaaqagvryslenpyayadanlmgylnilegcrhtkvkh
lvyassssvyglnrkmpfstedsvdhpvslyaatkkanelmahtyshlygipttglrfft
vygpwgrpdmalfkftkamlegksidvynygkmkrdftyiddiveavvrvldvipqanad
wtvesgspatssapyrvynignsspvelmdyitaleealgmeaqknmmpiqpgdvldtsa
dtqplydlvgfkpqtsvkdgvknfvdwykdyyqi

Sequence, based on observed residues (ATOM records): (download)

>d5u4qa1 c.2.1.0 (A:1-334) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkflvtgaagfigfhiaqrllneghnvvgidnmndyydvslkqarldrlaypafhfqqld
ladregmaklfateqfdrvihlaaqanpyayadanlmgylnilegcrhtkvkhlvyasss
svyglnrkmpfstedsvdhpvslyaatkkanelmahtyshlygipttglrfftvygpwgr
pdmalfkftkamlegksidvynygkmkrdftyiddiveavvrvldvipqanadwtvesgs
patssapyrvynignsspvelmdyitaleealgmeaqknmmpitsadtqplydlvgfkpq
tsvkdgvknfvdwykdyyqi

SCOPe Domain Coordinates for d5u4qa1:

Click to download the PDB-style file with coordinates for d5u4qa1.
(The format of our PDB-style files is described here.)

Timeline for d5u4qa1:

  • d5u4qa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5u4qa2