Lineage for d5wrnd1 (5wrn D:26-310)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190102Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2190103Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2190104Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2190142Protein Thymidylate synthase [55833] (7 species)
  7. 2190283Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2283975Domain d5wrnd1: 5wrn D:26-310 [327276]
    Other proteins in same PDB: d5wrna2, d5wrnb2, d5wrnc2, d5wrnd2, d5wrne2, d5wrnf2
    automated match to d1hvya_
    complexed with dc

Details for d5wrnd1

PDB Entry: 5wrn (more details), 2.39 Å

PDB Description: human thymidylate synthase complexed with dcmp
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d5wrnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wrnd1 d.117.1.1 (D:26-310) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikme

SCOPe Domain Coordinates for d5wrnd1:

Click to download the PDB-style file with coordinates for d5wrnd1.
(The format of our PDB-style files is described here.)

Timeline for d5wrnd1:

  • d5wrnd1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15