Lineage for d5u4qb1 (5u4q B:1-333)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (236 species)
    not a true protein
  7. 2095243Species Klebsiella pneumoniae [TaxId:573] [225753] (3 PDB entries)
  8. 2283973Domain d5u4qb1: 5u4q B:1-333 [327274]
    Other proteins in same PDB: d5u4qa2, d5u4qb2
    automated match to d4lisa_
    complexed with cl, nad

Details for d5u4qb1

PDB Entry: 5u4q (more details), 1.5 Å

PDB Description: 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad.
PDB Compounds: (B:) dtdp-glucose 4,6-dehydratase

SCOPe Domain Sequences for d5u4qb1:

Sequence, based on SEQRES records: (download)

>d5u4qb1 c.2.1.0 (B:1-333) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkflvtgaagfigfhiaqrllneghnvvgidnmndyydvslkqarldrlaypafhfqqld
ladregmaklfateqfdrvihlaaqagvryslenpyayadanlmgylnilegcrhtkvkh
lvyassssvyglnrkmpfstedsvdhpvslyaatkkanelmahtyshlygipttglrfft
vygpwgrpdmalfkftkamlegksidvynygkmkrdftyiddiveavvrvldvipqanad
wtvesgspatssapyrvynignsspvelmdyitaleealgmeaqknmmpiqpgdvldtsa
dtqplydlvgfkpqtsvkdgvknfvdwykdyyq

Sequence, based on observed residues (ATOM records): (download)

>d5u4qb1 c.2.1.0 (B:1-333) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkflvtgaagfigfhiaqrllneghnvvgidnmndyydvslkqarldrlaypafhfqqld
ladregmaklfateqfdrvihlaaqagvrlenpyayadanlmgylnilegcrhtkvkhlv
yassssvyglnrkmpfstedsvdhpvslyaatkkanelmahtyshlygipttglrfftvy
gpwgrpdmalfkftkamlegrdftyiddiveavvrvldvipqanadwtvesgspatssap
yrvynignsspvelmdyitaleealgmtsadtqplydlvgfkpqtsvkdgvknfvdwykd
yyq

SCOPe Domain Coordinates for d5u4qb1:

Click to download the PDB-style file with coordinates for d5u4qb1.
(The format of our PDB-style files is described here.)

Timeline for d5u4qb1:

  • d5u4qb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5u4qb2