SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tsqa_ (5tsq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136776Protein automated matches [190287] (3 species)
    not a true protein
  7. 2283966Species Leishmania braziliensis [TaxId:1448350] [327267] (1 PDB entry)
  8. 2283967Domain d5tsqa_: 5tsq A: [327268]
    automated match to d1ezra_
    complexed with bdr, ca

Details for d5tsqa_

PDB Entry: 5tsq (more details), 1.53 Å

PDB Description: crystal structure of iunh from leishmania braziliensis in complex with d-ribose
PDB Compounds: (A:) IUnH

SCOPe Domain Sequences for d5tsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tsqa_ c.70.1.1 (A:) automated matches {Leishmania braziliensis [TaxId: 1448350]}
prkiildcdpgiddavaillaygnpeiellaittvvgnqtlekvtrnaqlvadvagivgv
piaagcckplvrkvrtapqihgetglgtvsypsefktkldkrhavhliielimshepksi
tlvptggltniamaarleprivervkevvlmggsccignaspvaefnifvdpeaahivfn
eswdvtmvgldltsqalatpevlqrvkevrtkpadfilkilefytkvyetqrntyakvhd
pcavayvidptvmttnrvpvnielngeltagmtvtdfryprpeqchtqvaskldfskywd
lvidalqrigdp

SCOPe Domain Coordinates for d5tsqa_:

Click to download the PDB-style file with coordinates for d5tsqa_.
(The format of our PDB-style files is described here.)

Timeline for d5tsqa_:

  • d5tsqa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15