Lineage for d5tpwl2 (5tpw L:108-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2283965Domain d5tpwl2: 5tpw L:108-212 [327266]
    Other proteins in same PDB: d5tpwl1
    automated match to d1tqbc2
    complexed with gol, nag, so4, zn

Details for d5tpwl2

PDB Entry: 5tpw (more details), 2.91 Å

PDB Description: crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at the glun2a
PDB Compounds: (L:) Fab, light chain

SCOPe Domain Sequences for d5tpwl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpwl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqlaaggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5tpwl2:

Click to download the PDB-style file with coordinates for d5tpwl2.
(The format of our PDB-style files is described here.)

Timeline for d5tpwl2:

  • d5tpwl2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15