SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpwl1 (5tpw L:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (546 PDB entries)
  8. 2283964Domain d5tpwl1: 5tpw L:1-107 [327265]
    Other proteins in same PDB: d5tpwl2
    automated match to d1a5fl1
    complexed with gol, nag, so4, zn

Details for d5tpwl1

PDB Entry: 5tpw (more details), 2.91 Å

PDB Description: crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at the glun2a
PDB Compounds: (L:) Fab, light chain

SCOPe Domain Sequences for d5tpwl1:

Sequence, based on SEQRES records: (download)

>d5tpwl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyasqsisgips
rfsgsgsgsdftltinsvepedvgmyycqnghsfprtfgggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d5tpwl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyaspsrfsgsg
sgsdftltinsvepedvgmyycqnghsfprtfgggtkleik

SCOPe Domain Coordinates for d5tpwl1:

Click to download the PDB-style file with coordinates for d5tpwl1.
(The format of our PDB-style files is described here.)

Timeline for d5tpwl1:

  • d5tpwl1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15