Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Zika virus (strain mr 766) [TaxId:64320] [319757] (3 PDB entries) |
Domain d5txga2: 5txg A:465-600 [327264] Other proteins in same PDB: d5txga1 automated match to d2bmfa1 complexed with k, trs |
PDB Entry: 5txg (more details), 2.05 Å
SCOPe Domain Sequences for d5txga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5txga2 c.37.1.0 (A:465-600) automated matches {Zika virus (strain mr 766) [TaxId: 64320]} edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs dhaalksfkefaagkr
Timeline for d5txga2: