Lineage for d5txga2 (5txg A:465-600)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129336Species Zika virus (strain mr 766) [TaxId:64320] [319757] (3 PDB entries)
  8. 2129338Domain d5txga2: 5txg A:465-600 [327264]
    Other proteins in same PDB: d5txga1
    automated match to d2bmfa1
    complexed with k, trs

Details for d5txga2

PDB Entry: 5txg (more details), 2.05 Å

PDB Description: crystal structure of the zika virus ns3 helicase.
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5txga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5txga2 c.37.1.0 (A:465-600) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs
dhaalksfkefaagkr

SCOPe Domain Coordinates for d5txga2:

Click to download the PDB-style file with coordinates for d5txga2.
(The format of our PDB-style files is described here.)

Timeline for d5txga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5txga1