SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5txga2 (5txg A:465-600)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (122 species)
    not a true protein
  7. 2276456Species Zika virus (strain mr 766) [TaxId:64320] [319757] (2 PDB entries)
  8. 2283963Domain d5txga2: 5txg A:465-600 [327264]
    Other proteins in same PDB: d5txga1
    automated match to d2bmfa1
    complexed with k, trs

Details for d5txga2

PDB Entry: 5txg (more details), 2.05 Å

PDB Description: crystal structure of the zika virus ns3 helicase.
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5txga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5txga2 c.37.1.0 (A:465-600) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs
dhaalksfkefaagkr

SCOPe Domain Coordinates for d5txga2:

Click to download the PDB-style file with coordinates for d5txga2.
(The format of our PDB-style files is described here.)

Timeline for d5txga2:

  • d5txga2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5txga1