Lineage for d5txga1 (5txg A:159-464)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113070Family c.37.1.14: RNA helicase [52724] (4 protein domains)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2113149Protein automated matches [226986] (8 species)
    not a true protein
  7. 2283961Species Zika virus (strain mr 766) [TaxId:64320] [327262] (2 PDB entries)
  8. 2283962Domain d5txga1: 5txg A:159-464 [327263]
    Other proteins in same PDB: d5txga2
    automated match to d2bhra2
    complexed with k, trs

Details for d5txga1

PDB Entry: 5txg (more details), 2.05 Å

PDB Description: crystal structure of the zika virus ns3 helicase.
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5txga1:

Sequence, based on SEQRES records: (download)

>d5txga1 c.37.1.14 (A:159-464) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
vecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeea
lrglpvrymttavnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpssi
aargyistrvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdh
sgktvwfvpsvrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemg
anfkadrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygg
gcaetd

Sequence, based on observed residues (ATOM records): (download)

>d5txga1 c.37.1.14 (A:159-464) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
vecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeea
lrglpvrymteivdlmchatftsrllqpirvpnynlyimdeahftdpssiaargyistrv
emgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwfvps
vrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemganfkadrvid
srrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygggcaetd

SCOPe Domain Coordinates for d5txga1:

Click to download the PDB-style file with coordinates for d5txga1.
(The format of our PDB-style files is described here.)

Timeline for d5txga1:

  • d5txga1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5txga2