SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5txga1 (5txg A:159-464)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113070Family c.37.1.14: RNA helicase [52724] (4 protein domains)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2113149Protein automated matches [226986] (7 species)
    not a true protein
  7. 2283961Species Zika virus (strain mr 766) [TaxId:64320] [327262] (1 PDB entry)
  8. 2283962Domain d5txga1: 5txg A:159-464 [327263]
    Other proteins in same PDB: d5txga2
    automated match to d2bhra2
    complexed with k, trs

Details for d5txga1

PDB Entry: 5txg (more details), 2.05 Å

PDB Description: crystal structure of the zika virus ns3 helicase.
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5txga1:

Sequence, based on SEQRES records: (download)

>d5txga1 c.37.1.14 (A:159-464) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
vecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeea
lrglpvrymttavnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpssi
aargyistrvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdh
sgktvwfvpsvrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemg
anfkadrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygg
gcaetd

Sequence, based on observed residues (ATOM records): (download)

>d5txga1 c.37.1.14 (A:159-464) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
vecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeea
lrglpvrymteivdlmchatftsrllqpirvpnynlyimdeahftdpssiaargyistrv
emgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwfvps
vrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemganfkadrvid
srrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygggcaetd

SCOPe Domain Coordinates for d5txga1:

Click to download the PDB-style file with coordinates for d5txga1.
(The format of our PDB-style files is described here.)

Timeline for d5txga1:

  • d5txga1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5txga2