SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mdmc_ (5mdm C:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223692Fold e.76: Viral glycoprotein ectodomain-like [161007] (1 superfamily)
    complex fold; contains three rigid, mostly-beta domains and an alpha-helical region, acting as a conformatiomal switch ("fusion stalk")
  4. 2223693Superfamily e.76.1: Viral glycoprotein ectodomain-like [161008] (3 families) (S)
  5. 2283911Family e.76.1.0: automated matches [327212] (1 protein)
    not a true family
  6. 2283912Protein automated matches [327213] (1 species)
    not a true protein
  7. 2283913Species Chandipura virus [TaxId:11272] [327214] (1 PDB entry)
  8. 2283960Domain d5mdmc_: 5mdm C: [327261]
    automated match to d5i2sa_
    complexed with fuc, nag, so4

Details for d5mdmc_

PDB Entry: 5mdm (more details), 3 Å

PDB Description: structural intermediates in the fusion associated transition of vesiculovirus glycoprotein
PDB Compounds: (C:) Glycoprotein

SCOPe Domain Sequences for d5mdmc_:

Sequence, based on SEQRES records: (download)

>d5mdmc_ e.76.1.0 (C:) automated matches {Chandipura virus [TaxId: 11272]}
ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelse

Sequence, based on observed residues (ATOM records): (download)

>d5mdmc_ e.76.1.0 (C:) automated matches {Chandipura virus [TaxId: 11272]}
ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
ktriqekhllplfkecpagtevrstlqsaqvltseiqrildyslcqntwdkverkeplsp
ldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdiwt
qwfkygdmeigpngllktaggykfpwhligmelhelse

SCOPe Domain Coordinates for d5mdmc_:

Click to download the PDB-style file with coordinates for d5mdmc_.
(The format of our PDB-style files is described here.)

Timeline for d5mdmc_:

  • d5mdmc_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15