SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxym_ (5lxy M:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (11 species)
    not a true protein
  7. 2175073Species Human (Homo sapiens) [TaxId:9606] [188315] (83 PDB entries)
  8. 2283952Domain d5lxym_: 5lxy M: [327253]
    automated match to d3ulha_
    protein/RNA complex; complexed with br

Details for d5lxym_

PDB Entry: 5lxy (more details), 2.85 Å

PDB Description: structure of the minimal rbm7 - zcchc8 complex
PDB Compounds: (M:) RNA-binding protein 7

SCOPe Domain Sequences for d5lxym_:

Sequence, based on SEQRES records: (download)

>d5lxym_ d.58.7.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpya
mnllngiklygrpikiqfr

Sequence, based on observed residues (ATOM records): (download)

>d5lxym_ d.58.7.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadrtlfvgnltkvtellfelfhqagpvikvqfafvnfkhevsvpyamnllngiklypik
iqfr

SCOPe Domain Coordinates for d5lxym_:

Click to download the PDB-style file with coordinates for d5lxym_.
(The format of our PDB-style files is described here.)

Timeline for d5lxym_:

  • d5lxym_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15