Lineage for d1f6mc_ (1f6m C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123183Family c.47.1.1: Thioltransferase [52834] (6 proteins)
  6. 123213Protein Thioredoxin [52835] (7 species)
  7. 123225Species Escherichia coli [TaxId:562] [52836] (9 PDB entries)
  8. 123232Domain d1f6mc_: 1f6m C: [32725]
    Other proteins in same PDB: d1f6ma1, d1f6ma2, d1f6mb1, d1f6mb2, d1f6me1, d1f6me2, d1f6mf1, d1f6mf2

Details for d1f6mc_

PDB Entry: 1f6m (more details), 2.95 Å

PDB Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+

SCOP Domain Sequences for d1f6mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6mc_ c.47.1.1 (C:) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d1f6mc_:

Click to download the PDB-style file with coordinates for d1f6mc_.
(The format of our PDB-style files is described here.)

Timeline for d1f6mc_: