SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wrnf1 (5wrn F:26-306)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190102Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2190103Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2190104Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2190142Protein Thymidylate synthase [55833] (7 species)
  7. 2190283Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2283948Domain d5wrnf1: 5wrn F:26-306 [327249]
    Other proteins in same PDB: d5wrna2, d5wrnb2, d5wrnc2, d5wrnd2, d5wrne2, d5wrnf2
    automated match to d1hvya_
    complexed with dc

Details for d5wrnf1

PDB Entry: 5wrn (more details), 2.39 Å

PDB Description: human thymidylate synthase complexed with dcmp
PDB Compounds: (F:) Thymidylate synthase

SCOPe Domain Sequences for d5wrnf1:

Sequence, based on SEQRES records: (download)

>d5wrnf1 d.117.1.1 (F:26-306) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

Sequence, based on observed residues (ATOM records): (download)

>d5wrnf1 d.117.1.1 (F:26-306) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkdgtlsvfgmqaryslrdefpllttkrvfwkgvleellw
fikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyrdme
sdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnselsc
qlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplkiqlq
reprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d5wrnf1:

Click to download the PDB-style file with coordinates for d5wrnf1.
(The format of our PDB-style files is described here.)

Timeline for d5wrnf1:

  • d5wrnf1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15