SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u4hb1 (5u4h B:1-418)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178854Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2178868Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2179069Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2179070Protein automated matches [190878] (13 species)
    not a true protein
  7. 2283943Species Acinetobacter baumannii [TaxId:470] [327244] (1 PDB entry)
  8. 2283946Domain d5u4hb1: 5u4h B:1-418 [327247]
    Other proteins in same PDB: d5u4ha2, d5u4hb2
    automated match to d2rl2a_
    complexed with 0v5, fmt, na

Details for d5u4hb1

PDB Entry: 5u4h (more details), 1.05 Å

PDB Description: 1.05 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from acinetobacter baumannii in covalently bound complex with (2r)-2-(phosphonooxy)propanoic acid.
PDB Compounds: (B:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d5u4hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4hb1 d.68.2.0 (B:1-418) automated matches {Acinetobacter baumannii [TaxId: 470]}
mdkflitggvklegevrisgaknaalpllaamiladspitltnvpnlkdvntlvkliggl
gvtisyendtvkadtstldnqfapyelvktmrasilvlgpllarygnakvslpggcaigs
rpvdqhlkalealgahievengyvhatvdgrlkggevvfdmvtvggtenilmaaaladgv
ttirnaarepeitdlaqmlikmgakiegldtdtlvvtgveslhgceyavvadrietgsyl
aaaaitggrvktthtdpslleavldkfeemgaevtrgddwieldmlgkrpkavsfrtlph
pefptdmqaqimavnaigrgfatisetifenrfmhvpelsrmganiqveghdavvtgvek
lqaapvmatdlrasfslvlaalvaegdtlidriyhidrgyehveeklqglgakikrvs

SCOPe Domain Coordinates for d5u4hb1:

Click to download the PDB-style file with coordinates for d5u4hb1.
(The format of our PDB-style files is described here.)

Timeline for d5u4hb1:

  • d5u4hb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5u4hb2