Lineage for d5u4ha1 (5u4h A:1-418)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178854Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2178868Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2179069Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2179070Protein automated matches [190878] (14 species)
    not a true protein
  7. 2283943Species Acinetobacter baumannii [TaxId:470] [327244] (1 PDB entry)
  8. 2283944Domain d5u4ha1: 5u4h A:1-418 [327245]
    Other proteins in same PDB: d5u4ha2, d5u4hb2
    automated match to d2rl2a_
    complexed with 0v5, fmt, na

Details for d5u4ha1

PDB Entry: 5u4h (more details), 1.05 Å

PDB Description: 1.05 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from acinetobacter baumannii in covalently bound complex with (2r)-2-(phosphonooxy)propanoic acid.
PDB Compounds: (A:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d5u4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4ha1 d.68.2.0 (A:1-418) automated matches {Acinetobacter baumannii [TaxId: 470]}
mdkflitggvklegevrisgaknaalpllaamiladspitltnvpnlkdvntlvkliggl
gvtisyendtvkadtstldnqfapyelvktmrasilvlgpllarygnakvslpggcaigs
rpvdqhlkalealgahievengyvhatvdgrlkggevvfdmvtvggtenilmaaaladgv
ttirnaarepeitdlaqmlikmgakiegldtdtlvvtgveslhgceyavvadrietgsyl
aaaaitggrvktthtdpslleavldkfeemgaevtrgddwieldmlgkrpkavsfrtlph
pefptdmqaqimavnaigrgfatisetifenrfmhvpelsrmganiqveghdavvtgvek
lqaapvmatdlrasfslvlaalvaegdtlidriyhidrgyehveeklqglgakikrvs

SCOPe Domain Coordinates for d5u4ha1:

Click to download the PDB-style file with coordinates for d5u4ha1.
(The format of our PDB-style files is described here.)

Timeline for d5u4ha1:

  • d5u4ha1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5u4ha2