SCOP 1.73: Domain d1txxa_: 1txx A:

Lineage for d1txxa_ (1txx A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Escherichia coli [TaxId:562] [52836] (29 PDB entries)

8. Domain d1txxa_: 1txx A: [32724]
   active-site variant
   complexed with cu; mutant

Details for d1txxa_

PDB Entry: 1txx, 2.2 Å

PDB Description: active-site variant of e.coli thioredoxin

PDB Compounds: (A:) protein (thioredoxin)

SCOP Domain Sequences for d1txxa_:

Sequence; same for both SEQRES and ATOM records:

>d1txxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcvwckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1txxa_:

• d1txxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1txxa_ appears in SCOP 1.71
  
• d1txxa_ appears in SCOP 1.75
  
• d1txxa_ appears in the current release, SCOPe 2.08