SCOPe 2.06: Domain d5m33a1: 5m33 A:113-201

Lineage for d5m33a1 (5m33 A:113-201)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.135: Tetraspanin [48651] (1 superfamily)
   5 helices: irregular disulfide-linked array; form homodimer

4. Superfamily a.135.1: Tetraspanin [48652] (1 family)

5. Family a.135.1.1: Tetraspanin [48653] (2 protein domains)

6. Protein automated matches [256548] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256549] (11 PDB entries)

8. Domain d5m33a1: 5m33 A:113-201 [327238]
   Other proteins in same PDB: d5m33a2, d5m33b2
   automated match to d1g8qa_
   complexed with edo

Details for d5m33a1

PDB Entry: 5m33, 1.28 Å

PDB Description: structural tuning of cd81lel (space group p21)

PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d5m33a1:

Sequence; same for both SEQRES and ATOM records:

>d5m33a1 a.135.1.1 (A:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgk

Timeline for d5m33a1:

• d5m33a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15