SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m33a1 (5m33 A:113-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012284Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2012285Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2012286Family a.135.1.1: Tetraspanin [48653] (2 protein domains)
  6. 2012293Protein automated matches [256548] (3 species)
    not a true protein
  7. 2012296Species Human (Homo sapiens) [TaxId:9606] [256549] (11 PDB entries)
  8. 2283937Domain d5m33a1: 5m33 A:113-201 [327238]
    Other proteins in same PDB: d5m33a2, d5m33b2
    automated match to d1g8qa_
    complexed with edo

Details for d5m33a1

PDB Entry: 5m33 (more details), 1.28 Å

PDB Description: structural tuning of cd81lel (space group p21)
PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d5m33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m33a1 a.135.1.1 (A:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d5m33a1:

Click to download the PDB-style file with coordinates for d5m33a1.
(The format of our PDB-style files is described here.)

Timeline for d5m33a1:

  • d5m33a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

2283937
d5m33a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5m33a2