Lineage for d5mdma_ (5mdm A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223692Fold e.76: Viral glycoprotein ectodomain-like [161007] (1 superfamily)
    complex fold; contains three rigid, mostly-beta domains and an alpha-helical region, acting as a conformatiomal switch ("fusion stalk")
  4. 2223693Superfamily e.76.1: Viral glycoprotein ectodomain-like [161008] (3 families) (S)
  5. 2283911Family e.76.1.0: automated matches [327212] (1 protein)
    not a true family
  6. 2283912Protein automated matches [327213] (1 species)
    not a true protein
  7. 2283913Species Chandipura virus [TaxId:11272] [327214] (1 PDB entry)
  8. 2283936Domain d5mdma_: 5mdm A: [327237]
    automated match to d5i2sa_
    complexed with fuc, nag, so4

Details for d5mdma_

PDB Entry: 5mdm (more details), 3 Å

PDB Description: structural intermediates in the fusion associated transition of vesiculovirus glycoprotein
PDB Compounds: (A:) Glycoprotein

SCOPe Domain Sequences for d5mdma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mdma_ e.76.1.0 (A:) automated matches {Chandipura virus [TaxId: 11272]}
ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpld

SCOPe Domain Coordinates for d5mdma_:

Click to download the PDB-style file with coordinates for d5mdma_.
(The format of our PDB-style files is described here.)

Timeline for d5mdma_:

  • d5mdma_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15