Lineage for d5m96a_ (5m96 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (62 PDB entries)
  8. 2336480Domain d5m96a_: 5m96 A: [327236]
    automated match to d4wqpa_
    complexed with q6y

Details for d5m96a_

PDB Entry: 5m96 (more details), 1.77 Å

PDB Description: synthesis and biological evaluation of new triazolo and imidazolopyridine rorgt inverse agonists
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5m96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m96a_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhl

SCOPe Domain Coordinates for d5m96a_:

Click to download the PDB-style file with coordinates for d5m96a_.
(The format of our PDB-style files is described here.)

Timeline for d5m96a_: