SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m96a_ (5m96 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (5 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (33 PDB entries)
  8. 2283935Domain d5m96a_: 5m96 A: [327236]
    automated match to d4wqpa_
    complexed with q6y

Details for d5m96a_

PDB Entry: 5m96 (more details), 1.77 Å

PDB Description: synthesis and biological evaluation of new triazolo and imidazolopyridine rorgt inverse agonists
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5m96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m96a_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhl

SCOPe Domain Coordinates for d5m96a_:

Click to download the PDB-style file with coordinates for d5m96a_.
(The format of our PDB-style files is described here.)

Timeline for d5m96a_:

  • d5m96a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15