SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tc4a2 (5tc4 A:157-332)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2095073Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2283931Domain d5tc4a2: 5tc4 A:157-332 [327232]
    Other proteins in same PDB: d5tc4a1
    automated match to d4a5od2
    complexed with l34, nad, po4

Details for d5tc4a2

PDB Entry: 5tc4 (more details), 1.89 Å

PDB Description: crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d5tc4a2:

Sequence, based on SEQRES records: (download)

>d5tc4a2 c.2.1.0 (A:157-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhdpvtakpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl

Sequence, based on observed residues (ATOM records): (download)

>d5tc4a2 c.2.1.0 (A:157-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhkpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl

SCOPe Domain Coordinates for d5tc4a2:

Click to download the PDB-style file with coordinates for d5tc4a2.
(The format of our PDB-style files is described here.)

Timeline for d5tc4a2:

  • d5tc4a2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5tc4a1