SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tc4a1 (5tc4 A:36-156)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127441Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2127442Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2127755Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2127756Protein automated matches [226864] (28 species)
    not a true protein
  7. 2127835Species Human (Homo sapiens) [TaxId:9606] [225016] (3 PDB entries)
  8. 2283930Domain d5tc4a1: 5tc4 A:36-156 [327231]
    Other proteins in same PDB: d5tc4a2
    automated match to d4a5oa1
    complexed with l34, nad, po4

Details for d5tc4a1

PDB Entry: 5tc4 (more details), 1.89 Å

PDB Description: crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d5tc4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tc4a1 c.58.1.0 (A:36-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eavvisgrklaqqikqevrqeveewvasgnkrphlsvilvgenpashsyvlnktraaavv
ginsetimkpasiseeellnlinklnnddnvdgllvqlplpehiderricnavspdkdvd
g

SCOPe Domain Coordinates for d5tc4a1:

Click to download the PDB-style file with coordinates for d5tc4a1.
(The format of our PDB-style files is described here.)

Timeline for d5tc4a1:

  • d5tc4a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5tc4a2