Lineage for d5tc4a1 (5tc4 A:36-156)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127441Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2127442Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2127755Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2127756Protein automated matches [226864] (29 species)
    not a true protein
  7. 2127835Species Human (Homo sapiens) [TaxId:9606] [225016] (3 PDB entries)
  8. 2283930Domain d5tc4a1: 5tc4 A:36-156 [327231]
    Other proteins in same PDB: d5tc4a2
    automated match to d4a5oa1
    complexed with l34, nad, po4

Details for d5tc4a1

PDB Entry: 5tc4 (more details), 1.89 Å

PDB Description: crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d5tc4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tc4a1 c.58.1.0 (A:36-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eavvisgrklaqqikqevrqeveewvasgnkrphlsvilvgenpashsyvlnktraaavv
ginsetimkpasiseeellnlinklnnddnvdgllvqlplpehiderricnavspdkdvd
g

SCOPe Domain Coordinates for d5tc4a1:

Click to download the PDB-style file with coordinates for d5tc4a1.
(The format of our PDB-style files is described here.)

Timeline for d5tc4a1:

  • d5tc4a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5tc4a2