SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2n3ya_ (2n3y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980579Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980710Species Human (Homo sapiens) [TaxId:9606] [109644] (8 PDB entries)
    Uniprot P99999
  8. 2283929Domain d2n3ya_: 2n3y A: [327230]
    automated match to d3zcfa_
    complexed with mh0

Details for d2n3ya_

PDB Entry: 2n3y (more details)

PDB Description: nmr structure of the y48pcmf variant of human cytochrome c in its reduced state
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2n3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n3ya_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysftaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d2n3ya_:

Click to download the PDB-style file with coordinates for d2n3ya_.
(The format of our PDB-style files is described here.)

Timeline for d2n3ya_:

  • d2n3ya_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15