Lineage for d1t7pb_ (1t7p B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 180867Family c.47.1.1: Thioltransferase [52834] (6 proteins)
  6. 180897Protein Thioredoxin [52835] (7 species)
  7. 180909Species Escherichia coli [TaxId:562] [52836] (9 PDB entries)
  8. 180914Domain d1t7pb_: 1t7p B: [32723]
    Other proteins in same PDB: d1t7pa1, d1t7pa2

Details for d1t7pb_

PDB Entry: 1t7p (more details), 2.2 Å

PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin

SCOP Domain Sequences for d1t7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7pb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOP Domain Coordinates for d1t7pb_:

Click to download the PDB-style file with coordinates for d1t7pb_.
(The format of our PDB-style files is described here.)

Timeline for d1t7pb_: