Lineage for d5m3ta1 (5m3t A:114-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012284Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2012285Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2012286Family a.135.1.1: Tetraspanin [48653] (2 protein domains)
  6. 2012293Protein automated matches [256548] (3 species)
    not a true protein
  7. 2012296Species Human (Homo sapiens) [TaxId:9606] [256549] (11 PDB entries)
  8. 2283927Domain d5m3ta1: 5m3t A:114-201 [327228]
    Other proteins in same PDB: d5m3ta2, d5m3tb2
    automated match to d1g8qa_
    complexed with cl, edo

Details for d5m3ta1

PDB Entry: 5m3t (more details), 2.02 Å

PDB Description: structural tuning of cd81lel (space group p64)
PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d5m3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3ta1 a.135.1.1 (A:114-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
lcpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d5m3ta1:

Click to download the PDB-style file with coordinates for d5m3ta1.
(The format of our PDB-style files is described here.)

Timeline for d5m3ta1:

  • d5m3ta1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5m3ta2