Lineage for d5lxye_ (5lxy E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (11 species)
    not a true protein
  7. 2175073Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2283925Domain d5lxye_: 5lxy E: [327226]
    automated match to d3ulha_
    protein/RNA complex; complexed with br

Details for d5lxye_

PDB Entry: 5lxy (more details), 2.85 Å

PDB Description: structure of the minimal rbm7 - zcchc8 complex
PDB Compounds: (E:) RNA-binding protein 7

SCOPe Domain Sequences for d5lxye_:

Sequence, based on SEQRES records: (download)

>d5lxye_ d.58.7.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpy
amnllngiklygrpikiqfrs

Sequence, based on observed residues (ATOM records): (download)

>d5lxye_ d.58.7.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeadrtlfvgnletkvteellfelfhqagpvikvkipqfafvnfkhevsvpyamnllngi
klygrpikiqfrs

SCOPe Domain Coordinates for d5lxye_:

Click to download the PDB-style file with coordinates for d5lxye_.
(The format of our PDB-style files is described here.)

Timeline for d5lxye_:

  • d5lxye_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15