Lineage for d5m96b_ (5m96 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730008Domain d5m96b_: 5m96 B: [327225]
    automated match to d4wqpa_
    complexed with q6y

Details for d5m96b_

PDB Entry: 5m96 (more details), 1.77 Å

PDB Description: synthesis and biological evaluation of new triazolo and imidazolopyridine rorgt inverse agonists
PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5m96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m96b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlskthrqsilaklppkgklrslcsqhverlqifq

SCOPe Domain Coordinates for d5m96b_:

Click to download the PDB-style file with coordinates for d5m96b_.
(The format of our PDB-style files is described here.)

Timeline for d5m96b_: