![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (89 PDB entries) |
![]() | Domain d5lxya_: 5lxy A: [327224] automated match to d3ulha_ protein/RNA complex; complexed with br |
PDB Entry: 5lxy (more details), 2.85 Å
SCOPe Domain Sequences for d5lxya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lxya_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpya mnllngiklygrpikiqf
Timeline for d5lxya_: