SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m93b1 (5m93 B:0-73)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (20 species)
    not a true protein
  7. 2159501Species Human (Homo sapiens) [TaxId:9606] [187090] (74 PDB entries)
  8. 2283921Domain d5m93b1: 5m93 B:0-73 [327222]
    Other proteins in same PDB: d5m93b2, d5m93c2
    automated match to d1mg8a_
    complexed with rib, so4

Details for d5m93b1

PDB Entry: 5m93 (more details), 1.79 Å

PDB Description: crystal structure of sdea-modified ubiquitin.
PDB Compounds: (B:) Polyubiquitin-B

SCOPe Domain Sequences for d5m93b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m93b1 d.15.1.0 (B:0-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
niqkestlhlvlrl

SCOPe Domain Coordinates for d5m93b1:

Click to download the PDB-style file with coordinates for d5m93b1.
(The format of our PDB-style files is described here.)

Timeline for d5m93b1:

  • d5m93b1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15