SCOPe 2.06: Domain d1thoa_: 1tho A:

Lineage for d1thoa_ (1tho A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (47 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1thoa_: 1tho A: [32722]
   complexed with cu; mutant

Details for d1thoa_

PDB Entry: 1tho, 2.3 Å

PDB Description: crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1thoa_:

Sequence; same for both SEQRES and ATOM records:

>d1thoa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgrpckmiapildeiadeyqgkltvakln
idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1thoa_:

• d1thoa_ first appeared (with stable ids) in SCOP 1.55, called d1tho__
  
• d1thoa_ appears in SCOPe 2.05
  
• d1thoa_ appears in SCOPe 2.07
  
• d1thoa_ appears in the current release, SCOPe 2.08