Class a: All alpha proteins [46456] (290 folds) |
Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
Superfamily a.135.1: Tetraspanin [48652] (1 family) |
Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
Protein automated matches [256548] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries) |
Domain d5m4ra_: 5m4r A: [327219] Other proteins in same PDB: d5m4re2 automated match to d1g8qa_ complexed with edo, so4 |
PDB Entry: 5m4r (more details), 3.1 Å
SCOPe Domain Sequences for d5m4ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m4ra_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl cpsgsniisnlfkedchqkiddlfsg
Timeline for d5m4ra_: