SCOPe 2.08: Domain d5hz9e1: 5hz9 E:1-133

Lineage for d5hz9e1 (5hz9 E:1-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries)

8. Domain d5hz9e1: 5hz9 E:1-133 [327217]
   Other proteins in same PDB: d5hz9a2, d5hz9b2, d5hz9c2, d5hz9d2, d5hz9e2, d5hz9f2, d5hz9g2, d5hz9h2
   automated match to d3wvma_
   complexed with 5m8, cl, so4

Details for d5hz9e1

PDB Entry: 5hz9, 2.3 Å

PDB Description: human fabp3 in complex with 6-chloro-2-methyl-4-phenyl-quinoline-3- carboxylic acid

PDB Compounds: (E:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d5hz9e1:

Sequence; same for both SEQRES and ATOM records:

>d5hz9e1 b.60.1.2 (E:1-133) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

Timeline for d5hz9e1:

• d5hz9e1 first appeared in SCOPe 2.06
  
• d5hz9e1 appears in SCOPe 2.07