Lineage for d2tir__ (2tir -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315309Family c.47.1.1: Thioltransferase [52834] (7 proteins)
  6. 315343Protein Thioredoxin [52835] (7 species)
  7. 315355Species Escherichia coli [TaxId:562] [52836] (10 PDB entries)
  8. 315360Domain d2tir__: 2tir - [32721]
    complexed with cu; mutant

Details for d2tir__

PDB Entry: 2tir (more details), 2 Å

PDB Description: crystal structure analysis of a mutant escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid

SCOP Domain Sequences for d2tir__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tir__ c.47.1.1 (-) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpcemiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d2tir__:

Click to download the PDB-style file with coordinates for d2tir__.
(The format of our PDB-style files is described here.)

Timeline for d2tir__: