SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1oa1 (5b1o A:223-286)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993437Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1993477Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 1993478Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 protein domains)
  6. 2283807Protein automated matches [327108] (1 species)
    not a true protein
  7. 2283808Species Escherichia coli [TaxId:562] [327109] (2 PDB entries)
  8. 2283906Domain d5b1oa1: 5b1o A:223-286 [327207]
    Other proteins in same PDB: d5b1oa2
    automated match to d1joya_
    mutant

Details for d5b1oa1

PDB Entry: 5b1o (more details), 2.3 Å

PDB Description: dhp domain structure of envz p248a mutant
PDB Compounds: (A:) Osmolarity sensor protein EnvZ

SCOPe Domain Sequences for d5b1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1oa1 a.30.2.1 (A:223-286) automated matches {Escherichia coli [TaxId: 562]}
maagvkqladdrtllmagvshdlrtaltrirlatemmseqdgylaesinkdieecnaiie
qfid

SCOPe Domain Coordinates for d5b1oa1:

Click to download the PDB-style file with coordinates for d5b1oa1.
(The format of our PDB-style files is described here.)

Timeline for d5b1oa1:

  • d5b1oa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5b1oa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5b1ob_